Select one of the proteases and then upload a file containing fasta format sequence or multiple PDB files
Note: You can submit many proteins in fasta format at once in one fasta file
or enter PDB ids with single space or upload multiple PDB files using ctrl or shift button.
Query example:
Fasta input file: test.fasta
>fasta1
MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFSLNNLGRFADKLPSEP
RENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLND
TRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQQVPGFDEWLWVLAYPGI
>fasta2
MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQH
YEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR


PDB ids (a code is 4-char-ID seperated by single space): 3N85 4J72

PDB input files: 3N85.pdb, 4J72.pdb, etc
Select protease:
Upload fasta file:
OR
Enter PDB ids
OR
Upload PDB files:
Email ID(optional):